Skip to content

Instantly share code, notes, and snippets.

View colbyford's full-sized avatar
🧬

Colby T. Ford colbyford

🧬
View GitHub Profile
@colbyford
colbyford / README.md
Last active May 31, 2025 18:50
Score Folded Protein Complexes with HADDOCK3

Score Folded Protein Complexes with HADDOCK3

Colby T. Ford, Ph.D.

Motivation

HADDOCK3 provides a powerful workflow to docke two or more protein structures and it provides multiple metrics as an output for quantifying molecular binding affinity. However, a full docking pipeline may take some time to complete.

To get binding affinity metrics for PDB files where the protein complex already exists, we don't necessarily need to perform a full docking workflow. Also, there is a need to understand binding affinity in protein complex files generated from multimer folding prediction tools like AlphaFold3, Boltz-1, or ESM3.

@colbyford
colbyford / Colab_OpenMM.ipynb
Last active February 8, 2025 19:28
OpenMM in Google Colab
Loading
Sorry, something went wrong. Reload?
Sorry, we cannot display this file.
Sorry, this file is invalid so it cannot be displayed.
@colbyford
colbyford / Azure_ResourceGroupDeleter.json
Created November 17, 2024 19:00
Azure role that allows the deletion of resource groups within the subscription.
{
"properties": {
"roleName": "Resource Group Deleter",
"description": "Allows the deletion of resource groups within the subscription.",
"assignableScopes": [
"/subscriptions/<SUBSCRIPTION ID>"
],
"permissions": [
{
"actions": [
@colbyford
colbyford / README.md
Last active July 18, 2024 16:38
Expected value of |XY|^p for bivariate normal distribution where 0<p<2

Expected value of $|XY|^p$ for a bivariate normal distribution, where $(0 &lt; p &lt; 2)$

Disclaimer: This was generated using AI with Mathestral on Ollama and then edited by an underqualfied human.

Denote the bivariate normal random variables as $(X)$ and $(Y)$ with the following properties:

  • Mean vector: $\mu = (\mu_X, \mu_Y)$

  • Covariance matrix: $\Sigma = \binom{\sigma_X^2 , \rho \sigma_X \sigma_Y}{\rho \sigma_X \sigma_Y , \sigma_Y^2}$

Title URL
Predictions of the SARS-CoV-2 Omicron Variant (B.1.1.529) Spike Protein Receptor-Binding Domain Structure and Neutralizing Antibody Interactions https://www.frontiersin.org/articles/10.3389/fviro.2022.830202
An infectious SARS-CoV-2 B.1.1.529 Omicron virus escapes neutralization by therapeutic monoclonal antibodies https://www.nature.com/articles/s41591-021-01678-y
Imprinted SARS-CoV-2 humoral immunity induces convergent Omicron RBD evolution https://www.nature.com/articles/s41586-022-05644-7
Substantial Neutralization Escape by SARS-CoV-2 Omicron Variants BQ.1.1 and XBB.1 https://www.nejm.org/doi/10.1056/NEJMc2214314
ACE2 binding and antibody evasion in enhanced transmissibility of XBB.1.5 https://www.thelancet.com/journals/laninf/article/PIIS1473-3099(23)00010-5/fulltext
@colbyford
colbyford / shiny_app_in_docker.Dockerfile
Created October 25, 2022 18:40
Example Dockerfile for running a Shiny app in a container
# FROM rocker/shiny-verse:latest
FROM rocker/shiny-verse:4.0.0
## Install any Linux system dependencies
RUN apt-get update && apt-get install -y \
sudo \
libcurl4-gnutls-dev \
libcairo2-dev \
libxt-dev \
libssl-dev
@colbyford
colbyford / azure-databricks-with-vnet-and-nsg.json
Last active July 13, 2022 14:13
ARM Template for deploying Azure Databricks with a VNet and Network Security Group
{
"$schema": "https://schema.management.azure.com/schemas/2015-01-01/deploymentTemplate.json#",
"contentVersion": "1.0.0.0",
"parameters": {
"location": {
"type": "String",
"defaultValue" : "eastus"
},
"workspaceName": {
"type": "String",
@colbyford
colbyford / BA.2.75_BA.5_CC12.1_HADDOCK.md
Created July 6, 2022 15:18
Comparison of CC12.1 antibody binding affinity of SARS-CoV-2 Omicron subvariants BA.2.75 and BA.5.
Antibody Antibody PDB Variant Variant ID RBD PDB HADDOCK score Van der Waals energy Electrostatic energy Desolvation energy Restraints violation energy Buried Surface Area
CC12.1 6XC2 Alpha B.1.1.7 6XC2 -198.6 -106.9 -342.6 -37.5 143.2 2778.5
CC12.1 6XC2 Beta B.1.351 7VX1 -171.9 -93.9 -298.1 -33.1 147.3 2698.8
CC12.1 6XC2 Delta B.1.617.2 7V7O -178.8 -100.2 -290.8 -33 125.3 2682.3
CC12.1 6XC2 Omicron B.1.1.529 7T9J -118.5 -76.4 -169.6 -20.8 125.8 2121.4
CC12.1 6XC2 Omicron (Subvariant) BA.2.75 AlphaFold2 -118.8 -72.3 -265.7 -8.9 155.7 2265.6
CC12.1 6XC2 Omicron (Subvariant) BA.5 AlphaFold2 -121.4 -78 -198.3 -18.6 147.3 2326.3
@colbyford
colbyford / pembrolizumab_vs_pemfauxlizumab_pd-1_binding.md
Created June 8, 2022 00:22
Pembrolizumab vs. Pemfauxlizumab PD-1 Binding from HADDOCK
PD-1 Binding Pembrolizumab Pemfauxlizumab
HADDOCK score -138.0 +/- 0.8 -60.6 +/- 4.2
Van der Waals energy -84.8 +/- 3.8 -33.0 +/- 1.6
Electrostatic energy -232.2 +/- 25.9 -292.2 +/- 32.7
Desolvation energy -7.8 +/- 1.6 18.5 +/- 2.8
Restraints violation energy 9.5 +/- 4.9 123.5 +/- 28.9
Buried Surface Area 2204.2 +/- 53.3 1678.7 +/- 60.2
@colbyford
colbyford / pembrolizumab_pemfauxlizumab_fabs.fasta
Last active June 8, 2022 00:35
Comparison of Pembrolizumab and AlphaFold2-hallucinated "Pemfauxlizumab" Fab Sequences
>Pembrolizumab Light Chain
EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRLLIYLASYLESGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>Pemfauxlizumab Light Chain
PPTVTITPKHIHFDPGETFTVWATFSKPVYTDDGPKVKVYYRHPGGPYELLYKNATEKEPGWPDNIKTQYTGDRAWVTYDNMPECPHFYIYVRADVGGPPVWGKAVHLHCKCEPVPAEFYVIAAWLLWMLFWDVQIIAYVDGGCCEDHKVRVRLWGKDIKEPIKHYHPHCNPETNCHTHYYVLTLPAREFWKYRWVKFEYISPDGGKTQTAALWF
>Pembrolizumab Heavy Chain
QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGGINPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRDYRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRV
>Pemfauxlizumab Heavy Chain
EYKASCSRPIFCPIGETATITCTISGRDPRDENIMFYYRKPWGEMKYIGTVDTDDGKTTYDEEWKENVIATWDDDNNSATLTIKNLTRDMMMWFHVCVMDKKDGKGIDYCFSSARLFVFDKPFAAITAKKKDKAEIEVIACYPFHCHVSVGDGDDKDKLTQHYWKYTEDGYMICRVTKEKKVTAYCHRAGAKATIEE