Last active
October 11, 2022 12:51
-
-
Save stain/a7143d5276b927571a68f493cd388836 to your computer and use it in GitHub Desktop.
RO-Crate variant of https://github.com/BioSchemas/specifications/discussions/579
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| { | |
| "@context": "https://w3id.org/ro/crate/1.1/context", | |
| "@graph": [ | |
| { | |
| "@type": "CreativeWork", | |
| "@id": "ro-crate-metadata.json", | |
| "conformsTo": {"@id": "https://w3id.org/ro/crate/1.1"}, | |
| "about": {"@id": "https://disprot.org/#2021-08"} | |
| }, | |
| { | |
| "@id": "https://disprot.org/#2021-08", | |
| "@type": "Dataset", | |
| "conformsTo": { | |
| "@id": "https://bioschemas.org/profiles/Dataset/0.3-RELEASE-2019_06_14" | |
| }, | |
| "creator": { | |
| "@id": "https://biocomputingup.it/#Organization" | |
| }, | |
| "dateModified": "2021-08", | |
| "description": "DisProt is a database of intrinsically disordered proteins. Disordered regions are manually curated from literature. DisProt annotations cover both structural and functional aspects of disorder detected by specific experimental methods. Annotation concepts and detection methods are encoded in the Disorder Ontology.", | |
| "identifier": "https://disprot.org/#2020-12", | |
| "includedInDataCatalog": { | |
| "@id": "https://disprot.org/#DataCatalog" | |
| }, | |
| "keywords": [ | |
| "DisProt", | |
| "IDP", | |
| "IDPs", | |
| "intrinsic protein disorder", | |
| "protein annotation", | |
| "protein disorder", | |
| "manually curated" | |
| ], | |
| "license": { | |
| "@id": "https://creativecommons.org/licenses/by/4.0" | |
| }, | |
| "name": "DisProt", | |
| "url": { | |
| "@id": "https://disprot.org" | |
| }, | |
| "version": "8.3", | |
| "mentions": [ | |
| {"@id": "https://disprot.org/DP00003"}, | |
| {"@id": "https://disprot.org/DP00004"}, | |
| {"@id": "https://disprot.org/DP00005"} | |
| ] | |
| }, | |
| { | |
| "@id": "https://disprot.org/#DataCatalog", | |
| "@type": "DataCatalog", | |
| "conformsTo": { | |
| "@id": "https://bioschemas.org/profiles/DataCatalog/0.3-RELEASE-2019_07_01" | |
| }, | |
| "citation": { | |
| "@id": "https://doi.org/10.1093/nar/gkz975" | |
| }, | |
| "dataset": { | |
| "@id": "https://disprot.org/#2021-08" | |
| }, | |
| "dateModified": "2021-08", | |
| "datePublished": "2019-09", | |
| "description": "DisProt is a database of intrinsically disordered proteins. Disordered regions are manually curated from literature. DisProt annotations cover both structural and functional aspects of disorder detected by specific experimental methods. Annotation concepts and detection methods are encoded in the Disorder Ontology.", | |
| "encodingFormat": [ | |
| "text/html", | |
| "application/json" | |
| ], | |
| "identifier": "https://registry.identifiers.org/registry/disprot", | |
| "keywords": [ | |
| "DisProt", | |
| "IDP", | |
| "IDPs", | |
| "intrinsic protein disorder", | |
| "protein annotation", | |
| "protein disorder" | |
| ], | |
| "license": { | |
| "@id": "https://creativecommons.org/licenses/by/4.0" | |
| }, | |
| "name": "DisProt, The database of intrinsically disordered proteins", | |
| "provider": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/disprot/20210907/1/disprot.org/1195803267" | |
| }, | |
| "sameAs": { | |
| "@id": "https://registry.identifiers.org/registry/disprot" | |
| }, | |
| "sourceOrganization": { | |
| "@id": "https://biocomputingup.it/#Organization" | |
| }, | |
| "url": { | |
| "@id": "https://disprot.org" | |
| } | |
| }, | |
| { | |
| "@id": "https://biocomputingup.it/#Organization", | |
| "@type": "Organization", | |
| "conformsTo": { | |
| "@id": "https://bioschemas.org/profiles/Organization/0.2-DRAFT-2019_07_19" | |
| }, | |
| "description": "University of Padua, Department of Biomedical Sciences, BioComputing UP laboratory", | |
| "legalName": "University of Padua", | |
| "name": "BioComputing UP, Department of Biomedical Sciences, University of Padua", | |
| "sameAs": { | |
| "@id": "https://biocomputingup.it" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1343757371", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "334", | |
| "schema:rangeStart": "294" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1439209021", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "464", | |
| "schema:rangeStart": "454" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1748786242", | |
| "@type": "PropertyValue", | |
| "name": "Protein disorder content", | |
| "propertyID": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00499" | |
| }, | |
| "value": "9.829867674858223E-2" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1881427155", | |
| "@type": "DefinedTermSet", | |
| "name": "NCBI taxon", | |
| "url": { | |
| "@id": "https://bioportal.bioontology.org/ontologies/NCBITAXON" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1896912531", | |
| "@type": "DefinedTerm", | |
| "inDefinedTermSet": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1881427155" | |
| }, | |
| "sameAs": [ | |
| { | |
| "@id": "http://purl.uniprot.org/taxonomy/28285" | |
| }, | |
| { | |
| "@id": "https://identifiers.org/taxonomy:28285" | |
| }, | |
| { | |
| "@id": "http://purl.obolibrary.org/obo/NCBITaxon_28285" | |
| } | |
| ], | |
| "termCode": "28285", | |
| "url": { | |
| "@id": "http://purl.bioontology.org/ontology/NCBITAXON/28285" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1941496935", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "529", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/358568134", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/882439562", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/1619892227", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/1655452007", | |
| "@type": "PropertyValue", | |
| "name": "Protein disorder content", | |
| "propertyID": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00499" | |
| }, | |
| "value": "2.1764705882352942E-1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/1820736838", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00510" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/2045537157", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "170", | |
| "schema:rangeStart": "134" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/2105325746", | |
| "@type": "DefinedTermSet", | |
| "name": "NCBI taxon", | |
| "url": { | |
| "@id": "https://bioportal.bioontology.org/ontologies/NCBITAXON" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/271345528", | |
| "@type": "DefinedTerm", | |
| "inDefinedTermSet": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/2105325746" | |
| }, | |
| "sameAs": [ | |
| { | |
| "@id": "http://purl.uniprot.org/taxonomy/9606" | |
| }, | |
| { | |
| "@id": "https://identifiers.org/taxonomy:9606" | |
| }, | |
| { | |
| "@id": "http://purl.obolibrary.org/obo/NCBITaxon_9606" | |
| } | |
| ], | |
| "termCode": "9606", | |
| "url": { | |
| "@id": "http://purl.bioontology.org/ontology/NCBITAXON/9606" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/480974100", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "170", | |
| "schema:rangeStart": "134" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/499355226", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00050" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/960742943", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "170", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/98832210", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "170", | |
| "schema:rangeStart": "134" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1009444519", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1077537019", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "47", | |
| "schema:rangeStart": "34" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1199537498", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00063" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1257796954", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1271382721", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "107", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1413740343", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00050" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1535211358", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00511" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1557472421", | |
| "@type": "DefinedTermSet", | |
| "name": "NCBI taxon", | |
| "url": { | |
| "@id": "https://bioportal.bioontology.org/ontologies/NCBITAXON" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1603435240", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00050" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1666891346", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1682055931", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00066" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1786460745", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "107", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1895124567", | |
| "@type": "DefinedTerm", | |
| "inDefinedTermSet": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1557472421" | |
| }, | |
| "sameAs": [ | |
| { | |
| "@id": "http://purl.uniprot.org/taxonomy/10710" | |
| }, | |
| { | |
| "@id": "https://identifiers.org/taxonomy:10710" | |
| }, | |
| { | |
| "@id": "http://purl.obolibrary.org/obo/NCBITaxon_10710" | |
| } | |
| ], | |
| "termCode": "10710", | |
| "url": { | |
| "@id": "http://purl.bioontology.org/ontology/NCBITAXON/10710" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1906093950", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "107", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2005379000", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "107", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2011680892", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00510" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2079549948", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "36", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2145892216", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "47", | |
| "schema:rangeStart": "34" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/235465215", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "107", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/313846963", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "107", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/339817883", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "107", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/346339967", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/37194791", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/422739231", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00517" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/524863385", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "22", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/550065185", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "22", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/594029466", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00511" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/622723804", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00510" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/652441487", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00063" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/661824365", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "107", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/679459059", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "107", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/726966167", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "107", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/851963025", | |
| "@type": "PropertyValue", | |
| "name": "Term", | |
| "value": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00066" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/868802206", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "22", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/924391138", | |
| "@type": "PropertyValue", | |
| "name": "Protein disorder content", | |
| "propertyID": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00499" | |
| }, | |
| "value": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/945847033", | |
| "@type": "schema:SequenceRange", | |
| "schema:rangeEnd": "107", | |
| "schema:rangeStart": "1" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/disprot/20210907/1/disprot.org/1195803267", | |
| "@type": "Person", | |
| "email": "[email protected]", | |
| "familyName": "Tosatto", | |
| "givenName": "Silvio", | |
| "identifier": "https://orcid.org/0000-0003-4525-7793", | |
| "name": "Silvio Tosatto", | |
| "url": { | |
| "@id": "https://biocomputingup.it/people/silvio" | |
| } | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/profiles/DataCatalog/0.3-RELEASE-2019_07_01", | |
| "@type": "CreativeWork" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/profiles/Dataset/0.3-RELEASE-2019_06_14", | |
| "@type": "CreativeWork" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/profiles/Organization/0.2-DRAFT-2019_07_19", | |
| "@type": "CreativeWork" | |
| }, | |
| { | |
| "@id": "https://bioschemas.org/profiles/Protein/0.11-RELEASE", | |
| "@type": "CreativeWork" | |
| }, | |
| { | |
| "@id": "https://creativecommons.org/licensEs/by/4.0/", | |
| "@type": "CreativeWork", | |
| "name": "Creative Commons CC4 Attribution", | |
| "url": { | |
| "@id": "https://creativecommons.org/licenses/by/4.0" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org", | |
| "dct:title": "DisProt" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00003", | |
| "@type": "schema:Protein", | |
| "conformsTo": { | |
| "@id": "https://bioschemas.org/profiles/Protein/0.11-RELEASE" | |
| }, | |
| "dct:title": "DisProt", | |
| "schema:hasBioPolymerSequence": "MASREEEQRETTPERGRGAARRPPTMEDVSSPSPSPPPPRAPPKKRMRRRIESEDEEDSSQDALVPRTPSPRPSTSAADLAIAPKKKKKRPSPKPERPPSPEVIVDSEEEREDVALQMVGFSNPPVLIKHGKGGKRTVRRLNEDDPVARGMRTQEEEEEPSEAESEITVMNPLSVPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSKKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRWGRNVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIVFQCCNPVYRNSRAQGGGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF", | |
| "schema:hasSequenceAnnotation": [ | |
| { | |
| "@id": "https://disprot.org/DP00003#disorder-content" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00003r002" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00003r004" | |
| } | |
| ], | |
| "identifier": "https://identifiers.org/disprot:DP00003", | |
| "schema:includedInDataset": "https://disprot.org/#2021-08", | |
| "name": "DNA-binding protein", | |
| "sameAs": { | |
| "@id": "http://purl.uniprot.org/uniprot/P03265" | |
| }, | |
| "schema:taxonomicRange": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1896912531" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00003#disorder-content", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1748786242" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1941496935" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00003r002", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/358568134" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1343757371" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:8632448" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00003r004", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/882439562" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00003/20210907/1/disprot.org/DP00003/1439209021" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:8632448" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00004", | |
| "@type": "schema:Protein", | |
| "conformsTo": { | |
| "@id": "https://bioschemas.org/profiles/Protein/0.11-RELEASE" | |
| }, | |
| "dct:title": "DisProt", | |
| "schema:hasBioPolymerSequence": "MKTQRDGHSLGRWSLVLLLLGLVMPLAIIAQVLSYKEAVLRAIDGINQRSSDANLYRLLDLDPRPTMDGDPDTPKPVSFTVKETVCPRTTQQSPEDCDFKKDGLVKRCMGTVTLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES", | |
| "schema:hasSequenceAnnotation": [ | |
| { | |
| "@id": "https://disprot.org/DP00004#disorder-content" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00004r001" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00004r002" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00004r004" | |
| } | |
| ], | |
| "identifier": "https://identifiers.org/disprot:DP00004", | |
| "schema:includedInDataset": "https://disprot.org/#2021-08", | |
| "name": "Cathelicidin antimicrobial peptide", | |
| "sameAs": { | |
| "@id": "http://purl.uniprot.org/uniprot/P49913" | |
| }, | |
| "schema:taxonomicRange": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/271345528" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00004#disorder-content", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/1655452007" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/960742943" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00004r001", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/1619892227" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/480974100" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9452503" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00004r002", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/499355226" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/2045537157" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9452503" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00004r004", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/1820736838" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00004/20210907/2/disprot.org/DP00004/98832210" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9452503" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005", | |
| "@type": "schema:Protein", | |
| "conformsTo": { | |
| "@id": "https://bioschemas.org/profiles/Protein/0.11-RELEASE" | |
| }, | |
| "dct:title": "DisProt", | |
| "schema:hasBioPolymerSequence": "MDAQTRRRERRAEKQAQWKAANPLLVGVSAKPVNRPILSLNRKPKSRVESALNPIDLTVLAEYHKQIESNLQRIERKNQRTWYSKPGERGITCSGRQKIKGKSIPLI", | |
| "schema:hasSequenceAnnotation": [ | |
| { | |
| "@id": "https://disprot.org/DP00005#disorder-content" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r001" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r004" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r005" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r006" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r007" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r008" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r009" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r010" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r011" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r012" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r013" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r014" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r015" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r016" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r017" | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r018" | |
| } | |
| ], | |
| "identifier": "https://identifiers.org/disprot:DP00005", | |
| "schema:includedInDataset": "https://disprot.org/#2021-08", | |
| "name": "Antitermination protein N", | |
| "sameAs": { | |
| "@id": "http://purl.uniprot.org/uniprot/P03045" | |
| }, | |
| "schema:taxonomicRange": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1895124567" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005#disorder-content", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/924391138" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/235465215" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r001", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1257796954" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/661824365" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9659923" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r004", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/37194791" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/726966167" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:21936008" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r005", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1009444519" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/679459059" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9063900" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r006", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1682055931" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/339817883" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9063900" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r007", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/346339967" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2005379000" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9063900" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r008", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1535211358" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/313846963" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9063900" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r009", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/594029466" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1271382721" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9063900" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r010", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/622723804" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1786460745" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:30795892" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r011", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/422739231" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1906093950" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:30795892" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r012", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1603435240" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/868802206" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9659923" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r013", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1199537498" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1077537019" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9659923" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r014", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/652441487" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2145892216" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9659923" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r015", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/851963025" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/524863385" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9659923" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r016", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2011680892" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/550065185" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:9659923" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r017", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1666891346" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/945847033" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:10759866" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/DP00005r018", | |
| "@type": "schema:SequenceAnnotation", | |
| "additionalProperty": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/1413740343" | |
| }, | |
| "schema:sequenceLocation": { | |
| "@id": "https://bioschemas.org/crawl/v1/disprot/DP00005/20210907/3/disprot.org/DP00005/2079549948" | |
| }, | |
| "subjectOf": { | |
| "@id": "https://identifiers.org/pubmed:10759866" | |
| } | |
| }, | |
| { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl", | |
| "@type": "DefinedTermSet", | |
| "name": "IDP ontology" | |
| }, | |
| { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00050", | |
| "@type": "DefinedTerm", | |
| "inDefinedTermSet": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl" | |
| }, | |
| "name": "disorder to order", | |
| "termCode": "IDPO:00050" | |
| }, | |
| { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00063", | |
| "@type": "DefinedTerm", | |
| "inDefinedTermSet": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl" | |
| }, | |
| "name": "protein binding", | |
| "termCode": "IDPO:00063" | |
| }, | |
| { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00066", | |
| "@type": "DefinedTerm", | |
| "inDefinedTermSet": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl" | |
| }, | |
| "name": "RNA binding", | |
| "termCode": "IDPO:00066" | |
| }, | |
| { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00076", | |
| "@type": "DefinedTerm", | |
| "inDefinedTermSet": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl" | |
| }, | |
| "name": "disorder", | |
| "termCode": "IDPO:00076" | |
| }, | |
| { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00510", | |
| "@type": "DefinedTerm", | |
| "inDefinedTermSet": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl" | |
| }, | |
| "name": "molecular function regulator", | |
| "termCode": "IDPO:00510" | |
| }, | |
| { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00511", | |
| "@type": "DefinedTerm", | |
| "inDefinedTermSet": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl" | |
| }, | |
| "name": "molecular function activator activity", | |
| "termCode": "IDPO:00511" | |
| }, | |
| { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl#IDPO:00517", | |
| "@type": "DefinedTerm", | |
| "inDefinedTermSet": { | |
| "@id": "https://disprot.org/assets/data/IDPO_v0.2.owl" | |
| }, | |
| "name": "molecular adaptor activity", | |
| "termCode": "IDPO:00517" | |
| }, | |
| { | |
| "@id": "https://disprot.org/browse", | |
| "dct:title": "DisProt" | |
| }, | |
| { | |
| "@id": "https://doi.org/10.1093/nar/gkz975", | |
| "@type": "ScholarlyArticle", | |
| "name": "DisProt: intrinsic protein disorder annotation in 2020", | |
| "sameAs": [ | |
| { | |
| "@id": "https://academic.oup.com/nar/advance-article/doi/10.1093/nar/gkz975/5622715" | |
| }, | |
| { | |
| "@id": "https://pubmed.ncbi.nlm.nih.gov/31713636" | |
| } | |
| ], | |
| "url": { | |
| "@id": "https://doi.org/10.1093/nar/gkz975" | |
| } | |
| }, | |
| { | |
| "@id": "https://identifiers.org/pubmed:10759866", | |
| "@type": "ScholarlyArticle" | |
| }, | |
| { | |
| "@id": "https://identifiers.org/pubmed:21936008", | |
| "@type": "ScholarlyArticle" | |
| }, | |
| { | |
| "@id": "https://identifiers.org/pubmed:30795892", | |
| "@type": "ScholarlyArticle" | |
| }, | |
| { | |
| "@id": "https://identifiers.org/pubmed:8632448", | |
| "@type": "ScholarlyArticle" | |
| }, | |
| { | |
| "@id": "https://identifiers.org/pubmed:9063900", | |
| "@type": "ScholarlyArticle" | |
| }, | |
| { | |
| "@id": "https://identifiers.org/pubmed:9452503", | |
| "@type": "ScholarlyArticle" | |
| }, | |
| { | |
| "@id": "https://identifiers.org/pubmed:9659923", | |
| "@type": "ScholarlyArticle" | |
| } | |
| ] | |
| } |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment